PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038856.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family WOX
Protein Properties Length: 378aa    MW: 42922.9 Da    PI: 7.0654
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038856.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.44.4e-2290149357
                  --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Pbr038856.1  90 SRWNPTPEQLRALEELYRRgTRTPSAEQIQHITAQLrkygKIEGKNVFYWFQNHKARERQ 149
                  7*****************99**************************************97 PP

2Wus_type_Homeobox115.62.4e-3789151365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
        Pbr038856.1  89 SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIEGKNVFYWFQNHKARERQKR 151
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.6E-587154IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-990149IPR009057Homeodomain-like
PfamPF000468.8E-2090149IPR001356Homeobox domain
SuperFamilySSF466893.29E-1290155IPR009057Homeodomain-like
CDDcd000861.15E-691151No hitNo description
PROSITE profilePS5007111.22495150IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MWMMGYNDGG HGDFNMPDSF NGRKLRPLVP RPLPSVNNTV SSTITTPPCL NRSAIHGSHD  60
FFPQYHQLAA MAEQNKRSEF LNTPQVVVSS RWNPTPEQLR ALEELYRRGT RTPSAEQIQH  120
ITAQLRKYGK IEGKNVFYWF QNHKARERQK RRRQMESSAL SADHDQPLQI SMTSADNQKK  180
EESLGAGRTE FEVEETKNWA PFTNCSTTTL AEESVSIQRA AKARMAAAEC RADGWIQFDE  240
EELQQRRNFV ERNATWQMMQ LSCPSHPHPP THLINTPPTC ASTTTRSRAA ATGRTMDQSL  300
IKSHDLSIFI APYASETVFN IEQDHGCEES QTLQLFPLRS GHANTNELSI SEKDHEELSA  360
SFSAHPYPFF EFLPLKN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360081.10.0PREDICTED: WUSCHEL-related homeobox 1-like
TrEMBLM5WDG70.0M5WDG7_PRUPE; Uncharacterized protein
STRINGGLYMA05G33850.21e-145(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.14e-51WUSCHEL related homeobox 1